DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gstt3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:215 Identity:51/215 - (23%)
Similarity:93/215 - (43%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |:.|..|.|.|||::.:.|:..|:....:.::|..|:|....|.::||...:|.|.|..|.:.||
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAES 124

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTL--------YQSYVYYYYPQLFEDVKK 123
            .|||:||:.||......||:|.|.||.:::.|.:..:.|        :|..::..:      :.:
  Rat   125 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVF------LGQ 183

  Fly   124 PADPDN-----------LKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVST----FEISE 173
            |..|:.           |:.::|.|......|.|...:..:.:.:.:  |:..||.    ||   
  Rat   184 PVPPERLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITE--LMHPVSAGCKIFE--- 243

  Fly   174 YDFGKYPEVVRWYDNAKKVI 193
                ..|::..|....:..:
  Rat   244 ----SRPKLAAWRQRVEAAV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 26/72 (36%)
GstA 4..187 CDD:223698 50/205 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 20/128 (16%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 26/74 (35%)
GST_C_Theta 149..273 CDD:198292 19/126 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348116
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.