DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:205 Identity:62/205 - (30%)
Similarity:98/205 - (47%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELN--KKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIW 64
            |..|..|.|.||||:.:.|:|..:..|  |.|: |.|||||..||.|::..|.:|.|.|..|.:.
 Frog     6 LTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQL-LKAGEHLTQEFGKVSVLHKVPALKDGNFTMA 69

  Fly    65 ESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTL--YQSYVYYYYPQLFEDVKKPADP 127
            ||.|:|:|||.||......||.|.|:||.:::.|.:..:..  :.|.|::         .|...|
 Frog    70 ESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFW---------TKCVSP 125

  Fly   128 DNL------KKIDDAFAMFNT--------LLKGQQYAALNKLTLADFALLATVSTFEISEYD--- 175
            ..|      :|::...|.|.|        .|..:.:.|.:::::||  |:|.|...::....   
 Frog   126 TILGKEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVAD--LVAIVEIMQVIASGVNV 188

  Fly   176 FGKYPEVVRW 185
            |.:.|::..|
 Frog   189 FEERPKLGSW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 33/74 (45%)
GstA 4..187 CDD:223698 61/203 (30%)
GST_C_Delta_Epsilon 89..207 CDD:198287 23/116 (20%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 34/76 (45%)
GST_C_Theta 95..221 CDD:198292 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.