DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and clic5a

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:189 Identity:45/189 - (23%)
Similarity:71/189 - (37%) Gaps:36/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GLELNKKQVDLDAGEHLKP-EFVKINPQHTIPTLVDDGFAIWESRAILIYLAE-----KYDKDGS 82
            |:..|...|||..    || :...:.|....|.|..:|....:...|..:|.|     ||.|   
Zfish    42 GVVFNVTTVDLKR----KPADLHNLAPGTPPPFLTFNGEVRTDVNKIEEFLEEMLAPPKYPK--- 99

  Fly    83 LYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKID-----------DA 136
            |..|:.:.....|     |:...:.:|:....|:....::|.. ...|||:|           ||
Zfish   100 LAAKNKESNTAGN-----DIFAKFSAYIKNTKPEANASLEKGL-LKVLKKLDSFLNSPLPDEIDA 158

  Fly   137 FAMFNTLLKGQQYAALNKLTLADFALLATVSTFEI--SEYDFGKYPE----VVRWYDNA 189
            .:........::|...|:|||||..||..:...::  .:|...:.|.    |.|:..||
Zfish   159 ESTGEEKSSNRKYLDGNELTLADCNLLPKLHVVKVVSKKYRNFEIPSDLSGVWRYLQNA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 13/51 (25%)
GstA 4..187 CDD:223698 43/185 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 26/118 (22%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 14/58 (24%)
O-ClC 10..244 CDD:129941 45/189 (24%)
GST_C_CLIC5 104..244 CDD:198330 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.