DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstD4

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:209 Identity:122/209 - (58%)
Similarity:160/209 - (76%) Gaps:2/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            :||||...|:..|:|:|.|:||||||||||:.:..||||||||:|:|||||||||||:|||||||
  Fly     1 MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWES 65

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131
            |||.:||.|||.||.||:|.|||:||:|||||:||:.||:.|::.||||  |....:..:.:|.|
  Fly    66 RAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYP--FIRTGQLGNAENYK 128

  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW 196
            |::.||...:..|:||.|.|.::||:||.|:|::|||||:.|:|..|||.|.|||.||||:.|||
  Fly   129 KVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGW 193

  Fly   197 EENWEGCEYYKKLY 210
            :|||:|....|.:|
  Fly   194 DENWKGLLQMKTMY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 51/72 (71%)
GstA 4..187 CDD:223698 107/182 (59%)
GST_C_Delta_Epsilon 89..207 CDD:198287 59/117 (50%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 108/184 (59%)
GST_N_Delta_Epsilon 1..74 CDD:239343 51/72 (71%)
GST_C_Delta_Epsilon 88..204 CDD:198287 59/117 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468484
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.