DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:213 Identity:48/213 - (22%)
Similarity:88/213 - (41%) Gaps:27/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYSAP----CRSILMTARALGLELNKKQVDLDAGEHLK-PEFVKINPQHTIPTL-VDDGFAIWES 66
            ||:.|    ....|:.|:..|.:: |...:...||..| .||:|..|...:|.. ..:|..:.||
  Fly     6 LYTYPENFRAYKALIAAQYSGAQV-KVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSES 69

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131
            .||...||.:..:.|    |.|..:|.:.|.:.|..:.:..:...:.:| |...:.:..:....:
  Fly    70 NAIAYLLANEQLRGG----KCPFVQAQVQQWISFADNEIVPASCAWVFP-LLGILPQQKNSTAKQ 129

  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEY--------DFGKYPEVVRWYDN 188
            :.:......|..|:...:.|..::||||..:.:  |...:.||        .||   .|.||:..
  Fly   130 EAEAVLQQLNQKLQDATFLAGERITLADIVVFS--SLLHLYEYVLEPSVRSAFG---NVNRWFVT 189

  Fly   189 A--KKVIPGWEENWEGCE 204
            .  :|.:....::::.||
  Fly   190 ILNQKQVQAVVKDYKLCE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/72 (29%)
GstA 4..187 CDD:223698 45/192 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 23/126 (18%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 22/73 (30%)
GstA 5..187 CDD:223698 44/191 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 23/124 (19%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.