DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gsto1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:177 Identity:47/177 - (26%)
Similarity:78/177 - (44%) Gaps:19/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ARALGLELNKKQVDLDA---GEHLKPE-FVKINPQHTIPTL-VDDGFAIWESRAILIYLAEKYDK 79
            |:...|.||.|.:..|.   ....||: |::.||...:|.| ...|..|:||.....||.|.| .
Zfish    34 AQRTRLVLNAKGIKYDTININLKNKPDWFLEKNPLGLVPVLETQSGQVIYESPITCEYLDEVY-P 97

  Fly    80 DGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK-KIDDAFAMFNTL 143
            :..|.|.||.:||  .||:..:|.:....|.|    ::..:..|..|...|: ::.|..:.||.:
Zfish    98 EKKLLPFDPFERA--QQRMLLELFSKVTPYFY----KIPVNRTKGEDVSALETELKDKLSQFNEI 156

  Fly   144 L--KGQQYAALNKLTLADFAL---LATVSTFEISEYDFGKYPEVVRW 185
            |  |..::...:.:|:.|:.:   ...:.|..:.....|. ||:.:|
Zfish   157 LLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGT-PELKKW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/59 (32%)
GstA 4..187 CDD:223698 47/177 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 22/103 (21%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 18/58 (31%)
GstA 25..210 CDD:223698 47/177 (27%)
GST_C_Omega 107..229 CDD:198293 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.