DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstZ1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:201 Identity:44/201 - (21%)
Similarity:82/201 - (40%) Gaps:42/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMLYSAPCRSILMTARALGLELNKKQVDLD----------AGEHLKPEFVKINPQHTIPTLVDDG 60
            |..:.:.|...:..|.|:      |::|.|          :|.....|:.::||...:|:|..||
  Fly    37 YSYWPSSCSWRVRVALAI------KKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDG 95

  Fly    61 FAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPA 125
            ..:.:|.||:.||.|...:. :|.|:||.:||.|.:.:....|.:             :.::..:
  Fly    96 HTLCDSVAIIHYLEETRPQP-ALLPQDPVKRAKIREIVELICSGI-------------QPLQNVS 146

  Fly   126 DPDNLKK----------IDDAFAMFNTLL--KGQQYAALNKLTLADFALLATVSTFEISEYDFGK 178
            ..|::.|          |...|.....:|  ...::...::|::||..|:..|......:.|...
  Fly   147 VLDHIGKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKADLTP 211

  Fly   179 YPEVVR 184
            ||.:||
  Fly   212 YPTIVR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 20/78 (26%)
GstA 4..187 CDD:223698 44/201 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 19/108 (18%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 19/77 (25%)
maiA 35..240 CDD:273527 44/201 (22%)
GST_C_Zeta 122..236 CDD:198300 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460373
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.