DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gfzf

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:212 Identity:81/212 - (38%)
Similarity:116/212 - (54%) Gaps:24/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLDFYYM-LYSA----PCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDG 60
            ::..|.| ||:.    |..::.||.:||.::.....||..|.||...|:.|:|||..||.|.|||
  Fly   806 IVPIYTMKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDG 870

  Fly    61 FAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYP-------QLF 118
            |.:.||.||:.||.:||..|.:|||:|...||||||||.|::.       :||.|       .:|
  Fly   871 FYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMG-------FYYAPISAHSMAPIF 928

  Fly   119 EDVKKPADPDNLKKIDDAFAMFNTLLK--GQQYAALNKLTLADFALLATVSTFEISEYDFGKYPE 181
            .|.|:  .|.:|||:.:|..:|.|.|:  |.:|||...:|:|||||::.....|...:|..::..
  Fly   929 FDYKR--TPMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTL 991

  Fly   182 VVRWYDNAKKVIPG-WE 197
            |.:||:..|...|. ||
  Fly   992 VNKWYETFKVEYPQLWE 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 32/77 (42%)
GstA 4..187 CDD:223698 76/196 (39%)
GST_C_Delta_Epsilon 89..207 CDD:198287 42/119 (35%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 31/74 (42%)
GstA 812..1000 CDD:223698 76/196 (39%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 42/118 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.920

Return to query results.
Submit another query.