DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gstt1b

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:200 Identity:55/200 - (27%)
Similarity:104/200 - (52%) Gaps:8/200 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |:.|..|:|.||||:.:.|:...::.:.|::.|..|.....||.||||....||:.|..|.:.||
Zfish     3 LEIYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAES 67

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLST--LYQSYVYYY---YPQ-LFEDVKKPA 125
            .||:||||:|:......:|.|.|:||.:|:.|.:..::  ::.:.:.::   .|: |..:|.|..
Zfish    68 VAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKEK 132

  Fly   126 DPDNLKKIDDAFAMF-NTLLKGQQYAALNKLTLADF-ALLATVSTFEISEYDFGKYPEVVRWYDN 188
            ..:..:.::.|..:| :..|:.:.:...::::|||. |::..:..|......|...|::..|.|.
Zfish   133 MENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENRPKLKAWKDR 197

  Fly   189 AKKVI 193
            .:..|
Zfish   198 VRVAI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 29/72 (40%)
GstA 4..187 CDD:223698 52/190 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/112 (19%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 54/195 (28%)
GST_N_Theta 3..78 CDD:239348 30/74 (41%)
GST_C_Theta 91..217 CDD:198292 20/111 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.