DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gstt2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:214 Identity:58/214 - (27%)
Similarity:101/214 - (47%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAI 69
            |..|.|.|||::|:..:...:....:|:.:..||...|||.|:||...:|.|.|:||.:.||.||
Zfish    10 YLDLMSQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAI 74

  Fly    70 LIYLAEKYDKDGSLYPKDPQQRAVINQ-RLFFDLST-LYQSYVYYYYPQLFEDVKKP---ADPDN 129
            |.|||..|......|||.|::||.::: ..:..::| ::.:.|::      ::|..|   ..|.|
Zfish    75 LKYLATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFW------QEVLLPLMTGQPAN 133

  Fly   130 LKKIDDAFA--------MFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGK-YPEVVRW 185
            ..|::.|.:        :.|..||.|.:...:.::|||...:..:.....|..|..| .|:::.|
Zfish   134 TAKLEKALSDLSGTLDKLENMFLKRQAFLCGDDISLADLLAICELMQPMSSGRDILKDRPKLLSW 198

  Fly   186 -----------YDNAKKVI 193
                       :|.|..::
Zfish   199 RSRVQSALSDSFDEAHTIV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 28/69 (41%)
GstA 4..187 CDD:223698 56/206 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/130 (18%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 29/71 (41%)
GST_C_Theta 95..220 CDD:198292 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.