DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstO2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:202 Identity:48/202 - (23%)
Similarity:86/202 - (42%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVK-INPQHTIPTL----VDDGFAI 63
            |:.|.:......:.:...|..:|.:|..|||..    |||:.| .:|...:|.|    |.|...:
  Fly    25 FFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIE----KPEWYKDFSPLGKVPALQLTGVKDQPTL 85

  Fly    64 WESRAILIYLAEKYDKDGSLYPKDPQQRA---VINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPA 125
            .||..|..||.::|.:. .|:|.||.|:|   ::.:|        :...|...||.|..:...|.
  Fly    86 VESLIIAEYLDQQYPQT-RLFPTDPLQKALDKILIER--------FAPVVSAIYPVLTCNPNAPK 141

  Fly   126 DPDNLKKIDDAFAMFNTLL--KGQQYAALNKLTLADFAL--------LATVSTFEISEYDFGKYP 180
            |.  :...::|..:|...|  :|..|.|...:.:.|:.:        ...::|.:..|.|..::.
  Fly   142 DA--IPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFE 204

  Fly   181 EVVRWYD 187
            ::::|.|
  Fly   205 KLLKWRD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/75 (29%)
GstA 4..187 CDD:223698 47/200 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/112 (19%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/74 (28%)
GstA 25..215 CDD:223698 48/202 (24%)
GST_C_Omega 110..235 CDD:198293 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.