DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and se

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:194 Identity:41/194 - (21%)
Similarity:83/194 - (42%) Gaps:40/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ARALGLELNKKQVDLDAGEHL-------KPEF-VKINPQHTIPTLV---DDG-FAIWESRAILIY 72
            |:.:.|.|:.||:..    |.       |||: ::.|||..:|.|.   :.| ..:.||..|..|
  Fly    33 AQRVHLVLDAKQIPY----HSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEY 93

  Fly    73 LAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAF 137
            |.|:|.. ..|||:||.::  :..:|..:   .:::.:..::        |.:|..:|:......
  Fly    94 LDEQYPL-RPLYPRDPLKK--VQDKLLIE---RFRAVLGAFF--------KASDGGDLEPFWSGL 144

  Fly   138 AMFNTLL--KGQQYAALNKLTLADFAL--------LATVSTFEISEYDFGKYPEVVRWYDNAKK 191
            .::...|  :|.::....:..:.|:.:        |..:...|...||..::|::..|.:..|:
  Fly   145 DIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERMKR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 20/66 (30%)
GstA 4..187 CDD:223698 40/188 (21%)
GST_C_Delta_Epsilon 89..207 CDD:198287 14/113 (12%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 19/65 (29%)
GstA 22..215 CDD:223698 41/194 (21%)
GST_C_Omega 109..229 CDD:198293 14/113 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.