DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstO3

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:198 Identity:48/198 - (24%)
Similarity:84/198 - (42%) Gaps:59/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ARALGLELNKKQVD-----LDAGEHLKPEF-VKINPQHTIPTL---VDDGF-AIWESRAILIYLA 74
            |:...|.||.|.|.     ::..|  |||: |:::|...:|.|   .:.|. ::.||..|..||.
  Fly    33 AQRAHLVLNAKNVPYHSVYINLTE--KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLD 95

  Fly    75 EKYDKDGSLYPKDPQQRA---VINQRLFFDLSTLYQSYV-----------YYYYPQLFEDVKKPA 125
            :|| .:..|.||||.:||   ::.:|    .|::..:::           |:....:||      
  Fly    96 DKY-PENPLLPKDPLKRAQDKILLER----FSSITSAFINILVQGTGLEDYWTALDIFE------ 149

  Fly   126 DPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFAL---LATVSTFEI---SEYDF--GKYPEV 182
              :.|.|            :|..|...||....|:.:   ...:|..|:   .||:|  .::|::
  Fly   150 --EELTK------------RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKI 200

  Fly   183 VRW 185
            .:|
  Fly   201 TKW 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 48/198 (24%)
GstO3NP_648234.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 19/63 (30%)
GST_C_Omega 109..230 CDD:198293 21/119 (18%)

Return to query results.
Submit another query.