DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstE11

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:220 Identity:78/220 - (35%)
Similarity:127/220 - (57%) Gaps:10/220 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAI 69
            ||...|.|||::|:||.||||||:.:.|::.||||...||:|:|.|||||.|.|:|..:.:|..|
  Fly     8 YYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72

  Fly    70 LIYLAEKY--DKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKK 132
            ..|||:||  :.|.|||||||::|.:::.||::|...|:....:...|.::....: ...|.:..
  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGE-VPSDRVAY 136

  Fly   133 IDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFE-ISEYDFGKYPEVVRWYDNAKKV--IP 194
            :..|:......|....|...:|||:||.:.:|:|||.| .:..:..::|.:|:|   .|::  :|
  Fly   137 LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQW---VKRIQALP 198

  Fly   195 GWEE-NWEGCEYYKKLYLGAILNKQ 218
            .::: |.||.:....|..|.:..:|
  Fly   199 YYQKNNQEGLDMLVGLVKGLLAERQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 36/69 (52%)
GstA 4..187 CDD:223698 70/184 (38%)
GST_C_Delta_Epsilon 89..207 CDD:198287 28/121 (23%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 71/193 (37%)
GST_N_Delta_Epsilon 5..78 CDD:239343 36/69 (52%)
GST_C_Delta_Epsilon 94..211 CDD:198287 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460300
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.