DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstE8

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:197 Identity:67/197 - (34%)
Similarity:107/197 - (54%) Gaps:6/197 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MLY----SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESR 67
            :||    |.|.|:..:|..|||:.....:::..|.|.|.|||::.|||||:|||.|||..||:|.
  Fly     5 ILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSH 69

  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKK 132
            ||..||..||.:..:|||||..||||::|||.|:...::.:.:......||...:.....:....
  Fly    70 AISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDA 134

  Fly   133 IDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEI-SEYDFGKYPEVVRWYDNAKKVIPGW 196
            :.:.:....|.|.|..:.|.::||:|||:|:.:::...: ...|..||..:..|....:: :|.:
  Fly   135 VIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEE-LPYY 198

  Fly   197 EE 198
            ||
  Fly   199 EE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 64/184 (35%)
GstE8NP_611330.2 GstA 4..209 CDD:440390 67/197 (34%)

Return to query results.
Submit another query.