DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstE7

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:208 Identity:77/208 - (37%)
Similarity:116/208 - (55%) Gaps:3/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|.:..|.|.|::.:|..||.:.....:|:..|.|:...||:|.|||||:|||.|||..||:|
  Fly     4 LILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDS 68

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131
            .||:.||..||.|..||||||..||||::|||.|:...::.:.:......||...:.....:...
  Fly    69 HAIIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYD 133

  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEI-SEYDFGKYPEVVRWYDNAKKVIPG 195
            .|.:.:......|.|..|.|.|:||:|||::::|||:.|: .:.|..|||.:..|:...:| :|.
  Fly   134 AIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQK-LPY 197

  Fly   196 WEE-NWEGCEYYK 207
            :|| |..|...::
  Fly   198 YEEANGNGARTFE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 32/72 (44%)
GstA 4..187 CDD:223698 70/183 (38%)
GST_C_Delta_Epsilon 89..207 CDD:198287 36/119 (30%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 72/192 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 32/72 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460295
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.