DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstE4

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:214 Identity:73/214 - (34%)
Similarity:119/214 - (55%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            :..|.:..|.|.|:.|:|.:||.|......|:|...|:...:|.|.|||||:|.|.||...||:|
  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDS 68

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYV-YYYYPQLFEDVKKPADPDNL 130
            .||:.||.|||.....|||||..|||.::|.:.|:...:::|.: ....|.||  ..:|..|.| 
  Fly    69 HAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLF--FGEPTLPRN- 130

  Fly   131 KKIDDAFAMFN---TLLKGQQYAALNKLTLADFALLATVSTFEI-SEYDFGKYPEVVRWYDNAKK 191
             ::|....:::   |.|....:.|.::||:|||::::|:::..: .|.|..|||::..|.:..|:
  Fly   131 -QVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKE 194

  Fly   192 VIPGWEE-NWEGCEYYKKL 209
             :|.:|| |.:|...:.:|
  Fly   195 -LPYYEEANGKGAAQFVEL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 30/72 (42%)
GstA 4..187 CDD:223698 66/187 (35%)
GST_C_Delta_Epsilon 89..207 CDD:198287 34/123 (28%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GstA 6..196 CDD:223698 67/194 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/122 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460290
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.