DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstE3

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:198 Identity:78/198 - (39%)
Similarity:117/198 - (59%) Gaps:3/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|.:..|.|.||:|:|.|||.|:.:.|.|:|...|||||||:||||.||:|.|.|:||.:.:|
  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131
            .||..||..||.::.||||||.::||:::|||.:|.|.:..:.....:| ||.:.|.......:.
  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFP-LFWENKTEIPQARID 132

  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEI-SEYDFGKYPEVVRWYDNAKKVIPG 195
            .::..:...|..|:...|.|.:.||:|||.::|.::.|.: ...|..||||:..|....|: :|.
  Fly   133 ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKE-LPY 196

  Fly   196 WEE 198
            :||
  Fly   197 YEE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 74/185 (40%)
GstE3NP_611325.2 GstA 4..200 CDD:440390 78/198 (39%)

Return to query results.
Submit another query.