DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstE14

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:203 Identity:64/203 - (31%)
Similarity:114/203 - (56%) Gaps:8/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAI 69
            ||...|.|.||.||..:.|.:::..:.|:|..||..:.:|:.:||||::||||.....:.:|.||
  Fly     9 YYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAI 73

  Fly    70 LIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQ---SYVYYYYPQLFEDVKKPADPDNLK 131
            ||:||||:|:.|||:|::..:|..:...|.|:.|.|::   .::.....|.|.:|..   ..:.:
  Fly    74 LIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDV---AHHER 135

  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW 196
            |:.:|:.:....|:...:.|..:|||||.:::.|:||..:. :...::|.:.||: .|.:.:..:
  Fly   136 KLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWF-TAMQQLDAY 198

  Fly   197 EENWEGCE 204
            |.|..|.|
  Fly   199 EANCSGLE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 59/184 (32%)
GstE14NP_610855.1 GstA 7..200 CDD:440390 60/195 (31%)

Return to query results.
Submit another query.