DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and RGD1562107

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_343546.3 Gene:RGD1562107 / 363205 RGDID:1562107 Length:152 Species:Rattus norvegicus


Alignment Length:116 Identity:30/116 - (25%)
Similarity:54/116 - (46%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHT-----IPTLVDDGFAIWESRAILIYLA 74
            |:.....|.|:|..::..:      .:.||.|:....|     :|.:..||..:.::||||.|:|
  Rat    18 SVRWLLAAAGVEFEEELFE------TREEFEKLLQGGTLMYEQVPMVEIDGMNLVQTRAILRYVA 76

  Fly    75 EKYDKDGSLYPKDPQQRAVINQRL--FFDLSTLYQSYVYYYYPQLFEDVKK 123
            .|||    ||.::.:::|.|:..:  ..|||.:..     |:|....:.|:
  Rat    77 AKYD----LYGRNQEEQAWIDMYVEGLRDLSDMIM-----YFPLSLPEEKE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 16/64 (25%)
GstA 4..187 CDD:223698 30/116 (26%)
GST_C_Delta_Epsilon 89..207 CDD:198287 8/37 (22%)
RGD1562107XP_343546.3 Thioredoxin_like 4..82 CDD:412351 20/73 (27%)
GST_C_family 88..>139 CDD:413470 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485985at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.