DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and mars1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_956370.1 Gene:mars1 / 338183 ZFINID:ZDB-GENE-030219-83 Length:922 Species:Danio rerio


Alignment Length:291 Identity:58/291 - (19%)
Similarity:98/291 - (33%) Gaps:105/291 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRS--ILMTARALGLELNKKQVDLD--------AGEHLKPEFVKINPQHTIPTLVDDG------- 60
            |:.  ::.:::.|.|.|.|.:.||:        ||:.      ..|.:|...:.:.||       
Zfish   436 CKETPVIRSSKHLFLNLPKLEQDLEQWLQTSTAAGDW------TTNARHITRSWLRDGLKPRCIT 494

  Fly    61 ------------------FAIWESRAI-LIYLAEKYDKDGSLYPKDPQQRAVIN---------QR 97
                              |.:|....| .:.:...|......:.|:|||..:.|         ..
Zfish   495 RDLKWGTPVPHPDYKEKVFYVWFDAPIGYLSITANYTDQWERWWKNPQQVELYNFMAKDNVPFHS 559

  Fly    98 LFFDLS--------TLYQSYV---YYYYPQ----------LFEDVKK----PAD----------P 127
            :.|..|        ||..:.:   |..|..          :|.|:.|    |:|          |
Zfish   560 VVFPCSLLGAQDNYTLVNNLIATEYLNYEDTKFSKSRGVGVFGDMAKDTGIPSDVWRFYLLYLRP 624

  Fly   128 DNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKV 192
            :..   |.||:..:..||.......|   |.:|...|.:.   :|::..|..||:: ..|:.|::
Zfish   625 EGQ---DSAFSWTDMALKNNSELLNN---LGNFINRAGMF---VSKFFDGCVPEML-LNDDDKRL 679

  Fly   193 IPGWEENWEGCEYYKKL-------YLGAILN 216
            |.  :..||..:|.:.|       .|..|||
Zfish   680 IA--QVCWELKQYIQLLDKVRIRDALKCILN 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 16/97 (16%)
GstA 4..187 CDD:223698 47/253 (19%)
GST_C_Delta_Epsilon 89..207 CDD:198287 34/161 (21%)
mars1NP_956370.1 GstA 1..173 CDD:223698
GST_N_family 1..67 CDD:238319
GST_C_MetRS_N 75..176 CDD:198340
PRK12268 261..820 CDD:237029 58/291 (20%)
MetRS_core 263..631 CDD:173907 35/203 (17%)
Anticodon_Ia_Met 640..769 CDD:153411 19/78 (24%)
MetRS_RNA 866..910 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.