DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GstT3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:90/203 - (44%) Gaps:21/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVK-INPQHTIPTLVDDGFAIWESR 67
            :||.|.|.|.|::.:..|...:......|.|..||||..:|.| ||....:|.:.|:|:.:.||.
  Fly    47 YYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESV 111

  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPD---- 128
            |||.||:.|......||||....::.:::.|.:...:|..:...|:.....|.:.....|.    
  Fly   112 AILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKI 176

  Fly   129 ---------NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG-KYPEVV 183
                     ||..:::.:      |:|:.:...:.||:||......:....:::||.. |||::.
  Fly   177 ETFRMQMERNLDVVEEVW------LEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIR 235

  Fly   184 RWYDNAKK 191
            .|....::
  Fly   236 AWLKRVRQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 27/71 (38%)
GstA 4..187 CDD:223698 51/197 (26%)
GST_C_Delta_Epsilon 89..207 CDD:198287 19/117 (16%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 27/73 (37%)
GstA 47..243 CDD:223698 51/201 (25%)
GST_C_Theta 135..259 CDD:198292 19/115 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460046
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.