Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101367.1 | Gene: | Gdap1 / 312890 | RGDID: | 1309005 | Length: | 358 | Species: | Rattus norvegicus |
Alignment Length: | 267 | Identity: | 52/267 - (19%) |
---|---|---|---|
Similarity: | 86/267 - (32%) | Gaps: | 84/267 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
Fly 67 RAILIYLAEKY----------DKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVY--YYYPQLFE 119
Fly 120 DVKKPA-------------------------------------------DPDN---LKKIDD--- 135
Fly 136 -AFAMFNTLLK----------GQQYAALNKLTLADFALLATVST-----FEISEYDFGKYPEVVR 184
Fly 185 WYDNAKK 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 18/72 (25%) |
GstA | 4..187 | CDD:223698 | 49/259 (19%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 31/170 (18%) | ||
Gdap1 | NP_001101367.1 | GstA | 26..292 | CDD:223698 | 52/267 (19%) |
GST_N_GDAP1 | 26..98 | CDD:239350 | 17/71 (24%) | ||
GST_C_GDAP1 | 179..289 | CDD:198336 | 23/107 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348236 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |