DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gsto2

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:100 Identity:24/100 - (24%)
Similarity:40/100 - (40%) Gaps:36/100 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LKPEFVKIN------------PQHTIPTLVDDGFAIWESRAILIY---LAEKYDKD----GSLYP 85
            ::.|.:.||            |...:|.|.:       |:..|||   :|.:|..|    ..|:|
  Rat    47 IRHEIININLKNKPDWYYTKHPFGQVPVLEN-------SQCQLIYESVIACEYLDDVFPGRKLFP 104

  Fly    86 KDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFED 120
            .||.:||  .|::..:|        :...|||.::
  Rat   105 YDPYERA--RQKMLLEL--------FCKVPQLSKE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 24/99 (24%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 12/53 (23%)
GST_C_Omega 108..230 CDD:198293 7/31 (23%)

Return to query results.
Submit another query.