DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Mars1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_006241513.1 Gene:Mars1 / 299851 RGDID:1305321 Length:910 Species:Rattus norvegicus


Alignment Length:211 Identity:45/211 - (21%)
Similarity:76/211 - (36%) Gaps:63/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLY--SAPCRSILMTARALGLELNKKQV-DLDAGEHLKPEFVKINPQHTIPTLVDDGFAI 63
            :|.|..:.  :.|...::....|||.|.|...| :|.|.|:|..|              |..|: 
  Rat   548 VDLYQFMAKDNVPFHGLVFPCSALGAEDNYTLVKNLIATEYLNYE--------------DGKFS- 597

  Fly    64 WESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPD 128
             :||.|.::.....|..   .|.|                 :::.|:.|..|:            
  Rat   598 -KSRGIGVFGDMAQDTG---IPAD-----------------IWRFYLLYIRPE------------ 629

  Fly   129 NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVI 193
               ..|.||:..:.|:|.......|   |.:|...|.:.   :|::..|..||:|..:|:.:.|.
  Rat   630 ---GQDSAFSWTDLLIKNNSELLNN---LGNFINRAGMF---VSKFFGGCVPEMVLTHDDRRLVA 685

  Fly   194 PGWEENWEGCEYYKKL 209
               ..:||...|::.|
  Rat   686 ---HVSWELQRYHQLL 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/75 (25%)
GstA 4..187 CDD:223698 38/185 (21%)
GST_C_Delta_Epsilon 89..207 CDD:198287 22/117 (19%)
Mars1XP_006241513.1 Thioredoxin_like 1..68 CDD:294274
GstA <47..189 CDD:223698
GST_C_MetRS_N 77..179 CDD:198340
PRK12268 266..821 CDD:237029 45/211 (21%)
MetRS_core 267..635 CDD:173907 26/137 (19%)
Anticodon_Ia_Met 644..773 CDD:153411 15/64 (23%)
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.