DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Clic4

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:218 Identity:44/218 - (20%)
Similarity:70/218 - (32%) Gaps:90/218 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLF---------FDLSTLYQSYVYYYYPQLFED 120
            |.:..||.|..|...||......|     .:||||         |.::|:              |
Mouse    13 EDKEPLIELFVKAGSDGESIGNCP-----FSQRLFMILWLKGVVFSVTTV--------------D 58

  Fly   121 VK-KPADPDNL-------------------KKID---------------------------DAFA 138
            :| ||||..||                   .||:                           |.||
Mouse    59 LKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFA 123

  Fly   139 MFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNA--------KKVIPG 195
            .|:..:|..:..|...|   :..||.|:.  ::.||.....|:.:.  :|:        ::.:.|
Mouse   124 KFSAYIKNSRPEANEAL---ERGLLKTLQ--KLDEYLNSPLPDEID--ENSMEDIKFSTRRFLDG 181

  Fly   196 WEENWEGCEYYKKLYLGAILNKQ 218
            .|.....|....||::..::.|:
Mouse   182 DEMTLADCNLLPKLHIVKVVAKK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 4/9 (44%)
GstA 4..187 CDD:223698 37/177 (21%)
GST_C_Delta_Epsilon 89..207 CDD:198287 33/181 (18%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 24/106 (23%)
O-ClC 17..252 CDD:129941 43/214 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.