DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Clic3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:213 Identity:43/213 - (20%)
Similarity:70/213 - (32%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKY 77
            |:.:.|.....|:......||......:..:|.   |...:|.|:.||....::..|..:|.|  
  Rat    26 CQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEE-- 85

  Fly    78 DKDGSLYPKD------------------------------PQQRAVINQRLFFDLSTLYQSYVYY 112
                :|.|.|                              |.|...:.|:|...|:.|.:   |.
  Rat    86 ----TLGPPDFPGLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDDALYQQLLRALTRLDR---YL 143

  Fly   113 YYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG 177
            ..|...|..::|...::.::          .|.|.|      |||||.:||..:...:.....|.
  Rat   144 GTPLDHELAQEPHLSESRRR----------FLDGDQ------LTLADCSLLPKLHIVDTVCAHFR 192

  Fly   178 KYPE------VVRWYDNA 189
            :.|.      |.|:.|:|
  Rat   193 QRPIPAELSCVRRYLDSA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 13/61 (21%)
GstA 4..187 CDD:223698 41/209 (20%)
GST_C_Delta_Epsilon 89..207 CDD:198287 25/107 (23%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 43/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.