Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013098.2 | Gene: | Clic3 / 296566 | RGDID: | 1307249 | Length: | 237 | Species: | Rattus norvegicus |
Alignment Length: | 213 | Identity: | 43/213 - (20%) |
---|---|---|---|
Similarity: | 70/213 - (32%) | Gaps: | 64/213 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 CRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKY 77
Fly 78 DKDGSLYPKD------------------------------PQQRAVINQRLFFDLSTLYQSYVYY 112
Fly 113 YYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG 177
Fly 178 KYPE------VVRWYDNA 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 13/61 (21%) |
GstA | 4..187 | CDD:223698 | 41/209 (20%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 25/107 (23%) | ||
Clic3 | NP_001013098.2 | O-ClC | 6..230 | CDD:129941 | 43/213 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348162 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |