DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTT1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:213 Identity:57/213 - (26%)
Similarity:93/213 - (43%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |:.|..|.|.|||::.:.|:...:....:.|||..|:||...|.::||...:|.|.|..|.:.||
Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDV--KKPADPD- 128
            .|||:||..||......||:|.|.||.:::.|.:..:||.:|.:...:.::...|  .:|..|. 
Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQT 132

  Fly   129 ----------NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALL--------ATVSTFEISEYD 175
                      .|:.::|.|......|.|..      ::|||...:        |....||     
Human   133 LAATLAELDVTLQLLEDKFLQNKAFLTGPH------ISLADLVAITELMHPVGAGCQVFE----- 186

  Fly   176 FGKYPEVVRWYDNAKKVI 193
             |: |::..|....:..:
Human   187 -GR-PKLATWRQRVEAAV 202

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 28/72 (39%)
GstA 4..187 CDD:223698 56/203 (28%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/126 (19%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 28/74 (38%)