DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTA3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_000838.3 Gene:GSTA3 / 2940 HGNCID:4628 Length:222 Species:Homo sapiens


Alignment Length:176 Identity:49/176 - (27%)
Similarity:81/176 - (46%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCRSILMTARALGLELNKKQVDL--DAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLA 74
            |.|.:|..|   |:|..:|.:..  |.|: |:.:...:..|  :|.:..||..:.::||||.|:|
Human    18 PIRWLLAAA---GVEFEEKFIGSAEDLGK-LRNDGSLMFQQ--VPMVEIDGMKLVQTRAILNYIA 76

  Fly    75 EKYDKDGSLYPKDPQQRAVINQRL--FFDLSTLYQSYVYYYYPQLFEDVKKPADPD------NLK 131
            .||    :||.||.::||:|:...  ..||:.:.          |...:.:|.:.|      ..|
Human    77 SKY----NLYGKDIKERALIDMYTEGMADLNEMI----------LLLPLCRPEEKDAKIALIKEK 127

  Fly   132 KIDDAFAMFNTLLK--GQQYAALNKLTLADFALLATVSTFEISEYD 175
            .....|..|..:|:  ||.|...|||:.||.:|:..:  :.:.|.|
Human   128 TKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELL--YYVEELD 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/64 (30%)
GstA 4..187 CDD:223698 49/176 (28%)
GST_C_Delta_Epsilon 89..207 CDD:198287 23/97 (24%)
GSTA3NP_000838.3 GST_N_Alpha 4..82 CDD:239375 22/73 (30%)
Glutathione binding. /evidence=ECO:0000269|PubMed:15595823, ECO:0000269|PubMed:20083122 54..55 1/2 (50%)