DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTA2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_000837.3 Gene:GSTA2 / 2939 HGNCID:4627 Length:222 Species:Homo sapiens


Alignment Length:175 Identity:50/175 - (28%)
Similarity:79/175 - (45%) Gaps:35/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SILMTARALGLELNKKQV----DLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAE 75
            ||.....|.|:|..:|.:    |||   .|:.:...:..|  :|.:..||..:.::||||.|:|.
Human    18 SIRWLLAAAGVEFEEKFIKSAEDLD---KLRNDGYLMFQQ--VPMVEIDGMKLVQTRAILNYIAS 77

  Fly    76 KYDKDGSLYPKDPQQRAVINQRL--FFDLSTLYQSYVYYYYPQLFEDVKKPADPD-NLKKIDDA- 136
            ||    :||.||.:::|:|:..:  ..||..:.          |.....:|.:.| .|..|.:. 
Human    78 KY----NLYGKDIKEKALIDMYIEGIADLGEMI----------LLLPFSQPEEQDAKLALIQEKT 128

  Fly   137 ----FAMFNTLLK--GQQYAALNKLTLADFALLATVSTFEISEYD 175
                |..|..:||  ||.|...|||:.||..|:..:  :.:.|.|
Human   129 KNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELL--YYVEELD 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 19/63 (30%)
GstA 4..187 CDD:223698 50/175 (29%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/97 (25%)
GSTA2NP_000837.3 PTZ00057 1..198 CDD:173353 50/175 (29%)
GST_N_Alpha 4..82 CDD:239375 22/72 (31%)
Glutathione binding. /evidence=ECO:0000269|PubMed:20083122 54..55 1/2 (50%)