DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gst-34

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:167 Identity:44/167 - (26%)
Similarity:67/167 - (40%) Gaps:40/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRA---- 92
            :..||...||.:    .|....|.|..|||.:.:|.||..|||.|:...|    |.|:..|    
 Worm    43 IQSDAFLALKDK----TPFGRFPVLSIDGFDLAQSTAIHRYLARKFGYAG----KSPEDEAFADS 99

  Fly    93 VINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADP-DNLKKIDD---------AFAMFNTLLK-- 145
            :::|         .:.|:..:.|.|:  .:|...| :.:|:|.|         .|.:...:||  
 Worm   100 IVDQ---------VKEYLESFRPLLY--AQKSGKPEEEVKRIHDEVYIPVKNLLFKILTRILKES 153

  Fly   146 GQQYAALNKLTLADFALLATV-STFEISEYDFGKYPE 181
            ..:|...:.||.||..:...: |...|.|.|    ||
 Worm   154 KSEYLVGDGLTWADLVVADHLYSLTNIKELD----PE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 15/42 (36%)
GstA 4..187 CDD:223698 44/167 (26%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/110 (22%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 15/42 (36%)
PTZ00057 6..213 CDD:173353 44/167 (26%)
GST_C_Sigma_like 92..200 CDD:198301 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.