DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and CLIC4

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:191 Identity:43/191 - (22%)
Similarity:75/191 - (39%) Gaps:48/191 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LELNKKQVDLD---AGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAE-----KYDKDG 81
            ::|.:|..||.   .|.|  |.|:..|.:  :.|.|:         .|..:|.|     ||.|  
Human    57 VDLKRKPADLQNLAPGTH--PPFITFNSE--VKTDVN---------KIEEFLEEVLCPPKYLK-- 106

  Fly    82 SLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKID-----------D 135
             |.||.|:....     ..|:...:.:|:....|:..|.:::.. ...|:|:|           |
Human   107 -LSPKHPESNTA-----GMDIFAKFSAYIKNSRPEANEALERGL-LKTLQKLDEYLNSPLPDEID 164

  Fly   136 AFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW 196
            ..:|.:.....:::...|::||||..||..:...::..   .||    |.:|..|::...|
Human   165 ENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVA---KKY----RNFDIPKEMTGIW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 40/180 (22%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101 14/56 (25%)
O-ClC 17..252 CDD:129941 43/191 (23%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.