DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and AIMP3

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:160 Identity:35/160 - (21%)
Similarity:59/160 - (36%) Gaps:37/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LKPEFVKINPQHTIPTLVDD-----GFAIWESRAILIYLAEKYDKDGSLYPKDPQQ-RAVINQRL 98
            :.|..|::|.:..:......     |||     :||..||.:...:.:...:..:: .|.:.|  
  Fly    16 VNPGKVQLNEEQVVTRTSGQKKSVAGFA-----SILESLASESKSETAQNSRASREVEAQVYQ-- 73

  Fly    99 FFDLSTLY---QSYVYYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADF 160
            :.:.|.||   .|...|...||..|                   ||.|...:.|...:.:||||.
  Fly    74 WIEFSVLYVAPGSKDKYVSKQLLAD-------------------FNKLFASKSYLVGHFITLADL 119

  Fly   161 ALLATVSTF--EISEYDFGKYPEVVRWYDN 188
            |:...:...  .:|..|...|..:.||:|:
  Fly   120 AVYYAIYDLVKSLSPVDKEVYLNLSRWFDH 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 9/39 (23%)
GstA 4..187 CDD:223698 34/157 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 25/106 (24%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.