DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gsta2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_058709.2 Gene:Gsta2 / 24422 RGDID:2754 Length:222 Species:Rattus norvegicus


Alignment Length:162 Identity:50/162 - (30%)
Similarity:76/162 - (46%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALGLELNKKQV----DLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKYDKDGS 82
            |.|:|.::|.:    ||   |.||.:...:..|  :|.:..||..:.::||||.|:|.|||    
  Rat    25 AAGVEFDEKFIQSPEDL---EKLKKDGNLMFDQ--VPMVEIDGMKLAQTRAILNYIATKYD---- 80

  Fly    83 LYPKDPQQRAVINQRL--FFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLK 145
            ||.||.::||:|:...  ..||:.:....|  ..|...::.|.....|..|  :.....|..:||
  Rat    81 LYGKDMKERALIDMYTEGILDLTEMIMQLV--ICPPDQKEAKTALAKDRTK--NRYLPAFEKVLK 141

  Fly   146 --GQQYAALNKLTLADFALLATVSTFEISEYD 175
              ||.|...|:||..|..||..:  ..:.|:|
  Rat   142 SHGQDYLVGNRLTRVDIHLLELL--LYVEEFD 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/56 (32%)
GstA 4..187 CDD:223698 50/162 (31%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/91 (26%)
Gsta2NP_058709.2 GST_N_Alpha 4..82 CDD:239375 22/65 (34%)
Glutathione binding. /evidence=ECO:0000269|PubMed:11119643 54..55 1/2 (50%)