DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTA5

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_714543.1 Gene:GSTA5 / 221357 HGNCID:19662 Length:222 Species:Homo sapiens


Alignment Length:169 Identity:49/169 - (28%)
Similarity:78/169 - (46%) Gaps:23/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SILMTARALGLELNKKQV----DLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAE 75
            ||.....|.|:||.:|.:    |||   .|:.:...:..|  :|.:..||..:.::||||.|:|.
Human    18 SIRWLLAAAGVELEEKFLESAEDLD---KLRNDGSLLFQQ--VPMVEIDGMKLVQTRAILNYIAS 77

  Fly    76 KYDKDGSLYPKDPQQRAVINQRL--FFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAFA 138
            ||    :||.||.::||:|:...  ..||:.:....:.....:  .|.|.....:.:|  :..|.
Human    78 KY----NLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEE--RDAKTALVKEKIK--NRYFP 134

  Fly   139 MFNTLLKG--QQYAALNKLTLADFALLATVSTFEISEYD 175
            .|..:||.  |.|...|||:.||..|:...  :.:.|.|
Human   135 AFEKVLKSHRQDYLVGNKLSWADIHLVELF--YYVEELD 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 20/63 (32%)
GstA 4..187 CDD:223698 49/169 (29%)
GST_C_Delta_Epsilon 89..207 CDD:198287 22/91 (24%)
GSTA5NP_714543.1 PTZ00057 1..198 CDD:173353 49/169 (29%)
GST_N_Alpha 4..82 CDD:239375 23/72 (32%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P30711 54..55 1/2 (50%)