DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gst-43

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:185 Identity:52/185 - (28%)
Similarity:85/185 - (45%) Gaps:9/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMLYSAPCRSILMTARAL-GLELNKKQVDLDAGEHL-KPEFVKINPQHTIPTLVDDGFAIWESRA 68
            |..:.:.|...:..|.|| .::...:.:||.:.|.. ..||||.||...:||||.:|.::.||.|
 Worm     7 YSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLSLTESLA 71

  Fly    69 ILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKK- 132
            |:.||.|.| .|....||:..:|:.........::::........:..|.|  |:|...|.... 
 Worm    72 IIEYLDEAY-PDPPFLPKELDKRSYSRAIALHIVASIQPLQAINIHKMLNE--KEPGYGDFWCNH 133

  Fly   133 -IDDAFAMFNTLLK--GQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVR 184
             ::..|.....|||  ..:|...::||:||..|.:.:...:|.:.|..|||.:.|
 Worm   134 FVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIYKVDMSKYPTITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/70 (36%)
GstA 4..187 CDD:223698 52/185 (28%)
GST_C_Delta_Epsilon 89..207 CDD:198287 22/100 (22%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 24/69 (35%)
maiA 5..211 CDD:273527 52/185 (28%)
GST_C_Zeta 90..207 CDD:198300 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163426
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.