DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gst-17

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001309453.1 Gene:gst-17 / 185411 WormBaseID:WBGene00001765 Length:174 Species:Caenorhabditis elegans


Alignment Length:133 Identity:32/133 - (24%)
Similarity:54/133 - (40%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 FAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLST-LYQSYVYYYYPQLFEDVKKP 124
            |.|.:|.||..|||.|:...|.. .||         :.:.|.:| ||:.: :..:.::....:..
 Worm    26 FEIPQSGAINSYLARKFGFAGKT-AKD---------QAWVDATTDLYKDF-FEVFRKMIRARRNK 79

  Fly   125 ADPDNLKKIDDA---------FAMFNTLLKGQQ--YAALNKLTLADFALLATVSTFEISEYDFGK 178
            ...|.|.|:...         |.:.|.:|:..:  |...:.:||||.|:...|.:  :..|...|
 Worm    80 LPADELAKLTSEILIPARHPYFEILNGILERNKSGYLVGDDITLADLAISENVDS--LKNYGLFK 142

  Fly   179 YPE 181
            ..|
 Worm   143 AEE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 32/133 (24%)
gst-17NP_001309453.1 GST_C_Sigma_like 51..156 CDD:198301 21/107 (20%)

Return to query results.
Submit another query.