DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gst-24

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:213 Identity:50/213 - (23%)
Similarity:93/213 - (43%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FYYML--YSAPCRSILMTARALGLELNKKQVDLDAGE--HLKPEFVKINPQHTIPTLVDDGFAIW 64
            :|:.|  ::.|.|.:...|.   :|....:::....|  .|||:    .|...:|.|..|||.|.
 Worm     7 YYFNLRGWAEPARQLFKLAH---VEFEDVRIENGTPEWGALKPK----TPFGQLPFLSVDGFEIP 64

  Fly    65 ESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDN 129
            :|.|||.|||:|:...|....::....|:::|  |.|..|..:..:.         .::..:.:.
 Worm    65 QSAAILRYLAKKFGYAGKTSEEEAWVDAIVDQ--FKDFVTPLRQLIM---------AQRSGNAEE 118

  Fly   130 LKKI---------DDAFAMFNTLLKGQQYAAL--NKLTLADFALLATVSTFEISEYDFGKYPEVV 183
            :::|         |..|.:.|.:|:..:...|  :.:|.||..:...::|.|:... |.|:.|..
 Worm   119 IERIQKEVFAPARDTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEMLGV-FDKHGEEQ 182

  Fly   184 RWYDNAKKV--IPGWEEN 199
            :.....:||  ||..:|:
 Worm   183 KLAALREKVNEIPEIKEH 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/74 (31%)
GstA 4..187 CDD:223698 45/197 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 24/124 (19%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 23/74 (31%)
PTZ00057 6..208 CDD:173353 50/213 (23%)
GST_C_Sigma_like 85..191 CDD:198301 19/117 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.