DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gst-27

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:207 Identity:48/207 - (23%)
Similarity:86/207 - (41%) Gaps:35/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYL 73
            |..|.| ||.....:..|..:..:.....|:||.:    .|....|.|..|||.|.:|.||..||
 Worm    14 YGEPAR-ILFHLADVPFEDFRMTIGDGTWENLKAK----TPFGQAPVLSVDGFEIPQSAAINRYL 73

  Fly    74 AEKYDKDGSLYPKDPQQR----AVINQRLFFDLSTLYQSYVYYYYP--------QLFEDVKKPAD 126
            |:::...|    |.|:::    |:::|         |:.::.....        :..|:|.|...
 Worm    74 AKQFGYAG----KTPEEQAWTDAIVDQ---------YKDFMVSIKEVGKASAAGKSAEEVGKIIQ 125

  Fly   127 PDNLKKIDDAFAMFNTLLKGQQYAAL--NKLTLADFALLATVSTFEISE-YDFGKYPEVVRWYDN 188
            .|.:...|..|.:.|.:|:..:...|  :.||:||..::..::|.:..: :...:.|::|...:.
 Worm   126 SDLVPARDAFFVIINKILEKSKSGFLVGDGLTIADIVIVECITTLDKHQLFTASEQPKLVALREK 190

  Fly   189 --AKKVIPGWEE 198
              |...|..|.|
 Worm   191 VYAIPAIKKWVE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/65 (32%)
GstA 4..187 CDD:223698 44/192 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 23/127 (18%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 21/65 (32%)
PTZ00057 6..208 CDD:173353 48/207 (23%)
GST_C_Sigma_like 85..191 CDD:198301 19/114 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.