Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497116.1 | Gene: | gst-27 / 175166 | WormBaseID: | WBGene00001775 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 86/207 - (41%) | Gaps: | 35/207 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYL 73
Fly 74 AEKYDKDGSLYPKDPQQR----AVINQRLFFDLSTLYQSYVYYYYP--------QLFEDVKKPAD 126
Fly 127 PDNLKKIDDAFAMFNTLLKGQQYAAL--NKLTLADFALLATVSTFEISE-YDFGKYPEVVRWYDN 188
Fly 189 --AKKVIPGWEE 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 21/65 (32%) |
GstA | 4..187 | CDD:223698 | 44/192 (23%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 23/127 (18%) | ||
gst-27 | NP_497116.1 | GST_N_Sigma_like | 4..75 | CDD:239337 | 21/65 (32%) |
PTZ00057 | 6..208 | CDD:173353 | 48/207 (23%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 19/114 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |