DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gstz1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:187 Identity:51/187 - (27%)
Similarity:83/187 - (44%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMLYSAPCRSILMTARAL-GLELNKKQVDL--DAGEHLKPEFVKINPQHTIPTLVDDGFAIWESR 67
            |..:.:.|...:..|.|| |::.....::|  |.|:....||..:||...:|.|..||..|.:|.
Mouse     9 YSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSL 73

  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDN--- 129
            ||:.|| |:......|.|:|||:||::..     :|.|..|.:   .|.....|.|....:|   
Mouse    74 AIMEYL-EETRPIPRLLPQDPQKRAIVRM-----ISDLIASGI---QPLQNLSVLKQVGQENQMQ 129

  Fly   130 --LKKIDDAFAMFNTLLKGQ--QYAALNKLTLADFALLATVSTFEISEYDFGKYPEV 182
              .|.|...|.....:|:..  :|...:::::||..|:..|:..|..:.|...||.:
Mouse   130 WAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTI 186

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/71 (32%)
GstA 4..187 CDD:223698 51/187 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 23/101 (23%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 23/71 (32%)
maiA 7..211 CDD:273527 51/187 (27%)
Glutathione binding 14..19 1/4 (25%)