DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gsto1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:195 Identity:47/195 - (24%)
Similarity:78/195 - (40%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPE-FVKINPQHTIPTLVD-DGFAIWESR 67
            |.|.:....:..||..:|.|:......::|..    ||| |.:.||...:|.|.: .|..:.||.
Mouse    27 YSMRFCPFAQRTLMVLKAKGIRHEVININLKN----KPEWFFEKNPLGLVPVLENSQGHLVTESV 87

  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRL----FFDLSTLYQSYVYYYYPQLFEDVKKPADPD 128
            ....||.|.| .:..|:|.||.::|  .|::    |..:..|..|:|         ..|:..|..
Mouse    88 ITCEYLDEAY-PEKKLFPDDPYKKA--RQKMTLESFSKVPPLIASFV---------RSKRKEDSP 140

  Fly   129 NL--------KKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRW 185
            ||        ||:::....:.:.|.|...:.::.||...|..|..:...|...:.    |::..|
Mouse   141 NLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLEALELKECLAHT----PKLKLW 201

  Fly   186  185
            Mouse   202  201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 20/71 (28%)
GstA 4..187 CDD:223698 47/195 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/109 (19%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 19/70 (27%)
GstA 26..224 CDD:223698 47/195 (24%)