Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011241675.1 | Gene: | Gstt2 / 14872 | MGIID: | 106188 | Length: | 251 | Species: | Mus musculus |
Alignment Length: | 239 | Identity: | 60/239 - (25%) |
---|---|---|---|
Similarity: | 99/239 - (41%) | Gaps: | 54/239 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE- 65
Fly 66 ------SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSY------------VYY 112
Fly 113 YYPQLFEDVKKPADPD--NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYD 175
Fly 176 -FGKYPEVVRWYDN------------------------AKKVIP 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 26/79 (33%) |
GstA | 4..187 | CDD:223698 | 55/204 (27%) | ||
GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 29/145 (20%) | ||
Gstt2 | XP_011241675.1 | GST_N_Theta | 3..85 | CDD:239348 | 26/81 (32%) |
GST_C_Theta | 98..223 | CDD:198292 | 24/132 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844528 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.750 |