DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gstt2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:239 Identity:60/239 - (25%)
Similarity:99/239 - (41%) Gaps:54/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE- 65
            |:.|..|.|.|.|::.:.|:..|:....:.||:..|:|:..:|.::|..:.:|.|.|..|.:.| 
Mouse     3 LELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTES 67

  Fly    66 ------SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSY------------VYY 112
                  |.||||||:.||......||.|.|.||.:::.|.:....:..::            :..
Mouse    68 PSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGV 132

  Fly   113 YYPQLFEDVKKPADPD--NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYD 175
            ..||  |.|::..|..  .|::::|.|......|.|||      :||||...|..:.......|:
Mouse   133 QVPQ--EKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQ------VTLADLMSLEELMQPVALGYN 189

  Fly   176 -FGKYPEVVRWYDN------------------------AKKVIP 194
             |...|::..|.:.                        |||::|
Mouse   190 LFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 26/79 (33%)
GstA 4..187 CDD:223698 55/204 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 29/145 (20%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 26/81 (32%)
GST_C_Theta 98..223 CDD:198292 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.