| Sequence 1: | NP_001287303.1 | Gene: | GstD9 / 41502 | FlyBaseID: | FBgn0038020 | Length: | 218 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_034397.1 | Gene: | Gdap1 / 14545 | MGIID: | 1338002 | Length: | 358 | Species: | Mus musculus |
| Alignment Length: | 267 | Identity: | 53/267 - (19%) |
|---|---|---|---|
| Similarity: | 86/267 - (32%) | Gaps: | 84/267 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
Fly 67 RAILIYLAEKY----------DKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVY--YYYPQLFE 119
Fly 120 DVKKPA-------------------------------------------DPDN---LKKIDD--- 135
Fly 136 -AFAMFNTLLK----------GQQYAALNKLTLADFALLATVST-----FEISEYDFGKYPEVVR 184
Fly 185 WYDNAKK 191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstD9 | NP_001287303.1 | GST_N_Delta_Epsilon | 2..75 | CDD:239343 | 19/72 (26%) |
| GstA | 4..187 | CDD:223698 | 50/259 (19%) | ||
| GST_C_Delta_Epsilon | 89..207 | CDD:198287 | 31/170 (18%) | ||
| Gdap1 | NP_034397.1 | GST_N_GDAP1 | 26..98 | CDD:239350 | 18/71 (25%) |
| GST_C_GDAP1 | 179..289 | CDD:198336 | 23/107 (21%) | ||
| Required for mitochondrial localization. /evidence=ECO:0000250 | 320..358 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167844784 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||