DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and eEF1gamma

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_316859.4 Gene:eEF1gamma / 1277399 VectorBaseID:AGAMI1_013749 Length:427 Species:Anopheles gambiae


Alignment Length:196 Identity:45/196 - (22%)
Similarity:80/196 - (40%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYSAP----CRSILMTARALGLELNKKQVDLDAGE-HLKPEFVKINPQHTIPTL-VDDGFAIWES 66
            ||:.|    ...:|:.|:..|..: |...|...|| :....|::..|...:|.. ..||..:.||
Mosquito     5 LYTYPENFRAYKVLIAAQYSGTPV-KVAADFVFGETNCSEPFLQKFPSGKVPAYETKDGKYLTES 68

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131
            .||..|:|.:     .|...:...||.:...|.|..:.|..:...:.:|.:   ...|.:.:|::
Mosquito    69 NAIAYYVANE-----QLRGANDFHRAEVQSFLSFADNVLLPAVQGWTFPMI---GIVPYNKNNVE 125

  Fly   132 KIDD----AFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDF-------GKYPEVVRW 185
            :..:    ..|..|:.|..|.|....::||||..:.||:    :..|::       ..:..|.||
Mosquito   126 RAKEELRRGLAALNSRLLKQTYLVGERITLADVVVFATL----LHAYEYVLDPAFRAPFGAVNRW 186

  Fly   186 Y 186
            :
Mosquito   187 F 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 45/196 (23%)
eEF1gammaXP_316859.4 GST_N_EF1Bgamma 3..78 CDD:239342 21/73 (29%)
GST_C_EF1Bgamma_like 88..209 CDD:198290 23/107 (21%)
EF1G 270..372 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.