DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTO2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:64 Identity:21/64 - (32%)
Similarity:30/64 - (46%) Gaps:5/64 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KPE-FVKINPQHTIPTL-VDDGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDL 102
            ||| :...:|...||.| ......|:||.....||.:.| ....|:|.||.:||  .|::..:|
Human    59 KPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAY-PGRKLFPYDPYERA--RQKMLLEL 119

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 12/35 (34%)
GstA 4..187 CDD:223698 21/64 (33%)
GST_C_Delta_Epsilon 89..207 CDD:198287 4/14 (29%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 11/34 (32%)