DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and CLIC2

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:214 Identity:46/214 - (21%)
Similarity:83/214 - (38%) Gaps:64/214 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRSILMTARALGLELNKKQVDLDA-------------------GEHLKPEFVKINPQHTIPTLVD 58
            |:.:.|.....|::.|...||:..                   .:.||.:|:||. :....||..
Human    33 CQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIE-EFLEQTLAP 96

  Fly    59 DGFAIWESRAILIYLAEKYDKD----------GSLYPKDPQQRAVINQRLFFDLSTL--YQSYVY 111
            ..:.         :|:.||.:.          .|.|.|:.|:.|..|    |:.|.|  ::....
Human    97 PRYP---------HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKN----FEKSLLKEFKRLDD 148

  Fly   112 YYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEIS---- 172
            |....|.:::    |||:.::...:..:|   |.|.|      |||||.:||..::..:::    
Human   149 YLNTPLLDEI----DPDSAEEPPVSRRLF---LDGDQ------LTLADCSLLPKLNIIKVAAKKY 200

  Fly   173 -EYDF-GKYPEVVRWYDNA 189
             ::|. .::..|.|:..||
Human   201 RDFDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 14/80 (18%)
GstA 4..187 CDD:223698 44/210 (21%)
GST_C_Delta_Epsilon 89..207 CDD:198287 27/109 (25%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 13/63 (21%)
N-terminal 1..94 11/61 (18%)
O-ClC 12..245 CDD:129941 46/214 (21%)
Joint loop 95..106 1/19 (5%)
C-terminal 107..247 30/130 (23%)
Foot loop 151..171 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.