DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and Gsto1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:198 Identity:50/198 - (25%)
Similarity:81/198 - (40%) Gaps:39/198 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMLYSAPCRSILMTARALG-----LELNKKQVDLDAGEHLKPE-FVKINPQHTIPTLVD-DGFA 62
            |.|.:....:..||..:|.|     :.:|.|.         ||| |.:.||...:|.|.: .|..
  Rat    27 YSMRFCPFAQRTLMVLKAKGIRHEIININLKN---------KPEWFFEKNPFGLVPVLENTQGHL 82

  Fly    63 IWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYY--------YPQLFE 119
            |.||.....||.|.| .:..|:|.||.::|.  |::.|:|.:...|.|..:        :|.:.|
  Rat    83 ITESVITCEYLDEAY-PEKKLFPDDPYEKAC--QKMTFELFSKVPSLVTSFIRAKRKEDHPGIKE 144

  Fly   120 DVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYD--FGKYPEV 182
            ::||     ...|:::|.|...|...|.     |.|::.|:.:.......|..|.:  ....|::
  Rat   145 ELKK-----EFSKLEEAMAKKRTAFFGG-----NSLSMIDYLIWPWFQRLEALELNECIDHTPKL 199

  Fly   183 VRW 185
            ..|
  Rat   200 KLW 202

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/76 (29%)
GstA 4..187 CDD:223698 50/198 (25%)
GST_C_Delta_Epsilon 89..207 CDD:198287 22/107 (21%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 21/75 (28%)
GstA 26..214 CDD:223698 50/198 (25%)