DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and gstz1

DIOPT Version :9

Sequence 1:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:195 Identity:48/195 - (24%)
Similarity:87/195 - (44%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMLYSAPCRSILMTARAL-GLELNKKQVDL--DAGEHLKPEFVKINPQHTIPTLVDDGFAIWESR 67
            |..:.:.|...:..|.|. |:|.:::.::|  |.|..|..|:.::||...:|.|..||..:.:|.
 Frog    10 YGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQSL 74

  Fly    68 AILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKK 132
            ||:.|| |:...:..|.|:||::||.:  |:..|              |:...::...:...|:|
 Frog    75 AIIEYL-EETRPNPPLLPRDPKKRAQV--RMISD--------------QIASGIQPLQNLCVLQK 122

  Fly   133 IDD------------AFAMFNTLLK--GQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVV 183
            |.:            .|.....||:  ..:|...:::|:||..|:..|:.....:.|...||.:|
 Frog   123 IGETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTIV 187

  Fly   184  183
             Frog   188  187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/71 (31%)
GstA 4..187 CDD:223698 48/195 (25%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/109 (19%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 48/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.