DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and Timm22

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_116007.1 Gene:Timm22 / 79463 RGDID:68406 Length:192 Species:Rattus norvegicus


Alignment Length:126 Identity:39/126 - (30%)
Similarity:57/126 - (45%) Gaps:27/126 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RIVEDCGCAFMMGTIGGSLFEFLKG--FRNAPTGLQRRLYGGID-LVKMRTP------------- 59
            |.:|.|....::..:||    |:.|  |.....|:...:  |.| ....|||             
  Rat    62 RAMESCAFKAVLACVGG----FVLGGAFGVFTAGIDTNV--GFDPKDPYRTPTAREVLKDMGQRG 120

  Fly    60 -SIAGSFAVWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGC 119
             |.|.:||:.||.||..:|.:..||.:.|..||::||..|||.:..|.|::|.|    :||
  Rat   121 MSYAKNFAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFRAGVKAGA----IGC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 39/126 (31%)
Timm22NP_116007.1 Tim17 67..184 CDD:396842 37/121 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.