DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and timm17a

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001011183.1 Gene:timm17a / 496605 XenbaseID:XB-GENE-979217 Length:167 Species:Xenopus tropicalis


Alignment Length:131 Identity:75/131 - (57%)
Similarity:95/131 - (72%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPSIAGSFA 66
            ||.|:|||.|||:|||.||.||.|||.:|:.:|||||:|.||:.|..|.:..::.|.|.:.||||
 Frog     3 EYTREPCPWRIVDDCGGAFTMGMIGGGIFQAIKGFRNSPQGLKHRFKGSLISIRTRAPQLGGSFA 67

  Fly    67 VWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCLVLAMIEGAGAA 131
            |||..||.:||::|..|.:||.||||.|||.||.|||||||..||..||.:|.::||:|||||..
 Frog    68 VWGGLFSMIDCSMVKMRGKEDPWNSITSGALTGAILAARNGAVAMVGSAAMGGILLALIEGAGIC 132

  Fly   132 V 132
            :
 Frog   133 I 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 75/131 (57%)
timm17aNP_001011183.1 Tim17 1..167 CDD:382951 75/131 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.